PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo29G0023800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 298aa    MW: 31609.6 Da    PI: 8.4082
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo29G0023800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-3963122362
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      e alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Spipo29G0023800  63 EGALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 122
                      5689*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2746111IPR003851Zinc finger, Dof-type
PfamPF027018.8E-3365120IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60966120IPR003851Zinc finger, Dof-type
PROSITE patternPS01361068104IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MVFSSAPVYL DPPSWMQPTY QHEIGGGDSG QLPLAAPPRP EINPARLGST AERARLAKAA  60
PPEGALKCPR CESTNTKFCY FNNYSLSQPR HFCKTCRRYW TRGGALRNVP VGGGCRRNKR  120
SKSGSGGSRS AAADRHGGSS TSAVTPPCGG GAAHCGVLPP SQFPFMDYLA AANLRLNLPG  180
GQPVDALNCQ LSGGLEEWRI QQVQEFPHLT TMEQATVPPS MGLFQFQEEP PVSQLSMMKM  240
EENPQRLTLP EQYLGVAGNY HYWGGGACVG VPGGSASGGG WAADLPGFNP SSTSNLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1044335e-57AC104433.8 Oryza sativa chromosome 3 BAC OJ1754_E06 genomic sequence, complete sequence.
GenBankAP0149595e-57AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126115e-57CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420091.15e-80PREDICTED: dof zinc finger protein DOF5.1-like isoform X2
TrEMBLM0RF435e-73M0RF43_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P03660_0011e-72(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.14e-44OBF-binding protein 3